You have no items in your shopping cart.
Recombinant Human CD79A&CD79B Heterodimer Protein (Active)
SKU: orb2986827
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79A recombinant antibody. The EC50 is 8.012-9.339 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human CD79A&CD79B at 2 μg/mL can bind Anti-CD79B recombinant antibody. The EC50 is 14.85-17.47 ng/mL. |
| Tag | C-terminal mFc-Flag-tagged&C-terminal 10xHis-mFC-tagged |
| Molecular Weight | 41.3 kDa&43.1 kDa |
| Expression Region | 33-143aa&29-159aa |
| Protein Length | Heterodimer |
| Protein Sequence | LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNR&ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−/

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Human CD79A&CD79B Heterodimer Protein (Active) (orb2986827)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review