Recombinant Human coronavirus HKU1 Non-structural protein 4 (4)

SKU: orb1096678

Featured

Description

This Recombinant Human coronavirus HKU1 Non-structural protein 4 (4) spans the amino acid sequence from region 1-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Epigenetics, Non-Animal

Images & Validation

−

Item 1 of 1

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Yeast
Biological Origin	Human coronavirus HKU1 (isolate N5) (HCoV-HKU1)
Tag	C-terminal 6xHis-tagged
Expression Region	1-109aa
Protein Length	Full Length
MW	14.1 kDa
Purity	Greater than 90% as determined by SDS-PAGE.
Protein Sequence	MEVWRPSYKYSLITREFGVTDLEDLCFKYNYCQPCVGYCIVPLNVWCRKFGKFASYFVLRSHDTSHKNNFGVITSFTSYGNTVSEAVSKLVESASDFIAWRAEALNKYG

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Accessory protein 4 Non-structural protein of 12.5 kDa Orf4 protein

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

Q0ZME6

UniProt Details

−

No UniProt data available

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	13.6 kDa
Source:	Baculovirus

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	13.4 kDa
Source:	E.coli

Applications:	ELISA, WB
Reactivity:	Virus
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	ELISA, WB
Reactivity:	Virus
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	14 kDa
Source:	Yeast