You have no items in your shopping cart.
Featured
Active
Description
Research Area
Stem Cell & Developmental Biology
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Determined by its ability to inhibit 5.0 ng/ml of BMP-4 induced alkaline phosphatase production by ATDC-5 chondrogenic cells. The expected ED50 for this effect is 2.0-3.0 ng/ml of Noggin. |
| Tag | Tag free |
| Expression Region | 28-232aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | ≤10 EU/mg by the LAL method |
| MW | 23 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution containingPBS, 5% mannitoland 0.01% Tween 80, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Noggin; NOG
Similar Products
−Recombinant human Noggin protein (Active,CHO) [orb2328302]
> 95% as determined by SDS-PAGE
29-31 kDa
10 μg, 50 μg, 500 μgRecombinant Human Noggin protein(NOG) (Active) [orb1650599]
>95% as determined by SDS-PAGE and HPLC.
46.3 kDa
1 mg, 250 μg, 500 μg, 100 μg, 20 μg, 5 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide