You have no items in your shopping cart.
Recombinant Human Parathyroid hormone (PTH) (Active)
SKU: orb2985952
Active
Description
Research Area
Metabolism Research
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA.Immobilized Human PTH1R at 5 μg/mL can bind Human PTH. The EC50 is 3.156-3.564 μg/mL. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 32-115aa |
| Protein Length | Full Length of Mature Protein |
| MW | 38.3 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Parathyroid hormone; PTH; Parathormone; Parathyrin; PTH
Similar Products
−Recombinant Human Parathyroid hormone protein (PTH),15N Stable Isotope Labeled (Active) [orb1785078]
Greater than 97% as determined by SDS-PAGE.
9.5 kDa
E.Coli
10 μg, 500 μg, 100 μgRecombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active) [orb2986870]
Greater than 95% as determined by SDS-PAGE.
20.3 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Parathyroid hormone protein(PTH) (Active) [orb1650569]
>97% as determined by SDS-PAGE and HPLC.
9.4 kDa
1 mg, 500 μg, 250 μg, 100 μg, 20 μgRecombinant Human Parathyroid hormone protein(PTH) (Active) [orb1650570]
>97% as determined by SDS-PAGE and HPLC.
3.4 kDa
1 mg, 500 μg, 250 μg, 100 μg, 20 μgRecombinant Human Parathyroid hormone protein(PTH) (Active) [orb1650571]
>97% as determined by SDS-PAGE and HPLC.
4.1 kDa
1 mg, 500 μg, 250 μg, 100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide