Recombinant Human SLAM family member 7 (SLAMF7), partial (Active)

SKU: orb3155644

This product can be custom made

Active

Description

Recombinant Human SLAM family member 7 (SLAMF7), partial (Active)

Research Area

Immunology & Inflammation

Images & Validation

−

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	①Measured by its binding ability in a functional ELISA.Immobilized Human SLAMF7 at 2 μg/mL can bind anti-SLAMF7 recombinant antibody. The EC50 is 8.949-10.33 ng/mL. ②SLAMF7 Recombinant Monoclonal Antibody captured on Protein A Chip can bind Human SLAMF7 with an affinity constant of 0.18 nM as detected by MetaSPR Assay.
Tag	C-terminal 10xHis-tagged
Expression Region	23-226aa
Protein Length	Partial
Endotoxins	Less than 1.0 EU/ug as determined by LAL method.
MW	23.8 kDa
Purity	Greater than 95% as determined by SDS-PAGE.
Protein Sequence	SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSM

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

SLAM family member 7; CD2 subset 1; CD2-like receptor-activating cytotoxic cells; CRACC; Membrane protein FOAP-12; Novel Ly9; Protein 19A; CD antigen CD319

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

Q9NQ25

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols