You have no items in your shopping cart.
Recombinant Human Thymic stromal lymphopoietin (TSLP) (Active)
SKU: orb2986246
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA.Immobilized Human TSLP at 2 μg/mL can bind Anti-TSLP recombinant antibody. The EC50 is 5.487-6.214 ng/mL. ②Measured by its binding ability in a functional ELISA.Immobilized Human TSLP at 2 μg/mL can bind Human CRLF2 protein. The EC50 is 41.01-45.10 ng/mL. |
| Tag | N-terminal 6xHis-Myc-tagged |
| Expression Region | 29-159aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 19.1 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Thymic stromal lymphopoietin; TSLP
Similar Products
−- Item 1 of 3
Recombinant Human Thymic stromal lymphopoietin (TSLP) (R127A,R130A) (Active) [orb2659514]
Greater than 95% as determined by SDS-PAGE.
16.6 kDa
Mammalian cell
1 mg, 100 μg, 20 μg Recombinant Human Cytokine receptor-like factor 2 (CRLF2), partial, Biotinylated (Active) [orb2986016]
Greater than 95% as determined by SDS-PAGE.
28.6 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Cytokine receptor-like factor 2 (CRLF2), partial (Active) [orb2985925]
Greater than 90% as determined by SDS-PAGE. Greater than 95% as determined by SEC-HPLC.
52.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μgRecombinant Human Thymic stromal lymphopoietin protein(TSLP) (Active) [orb1650507]
>98% as determined by SDS-PAGE and HPLC.
15.1 kDa
10 μg, 1 mg, 500 μg, 250 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days