Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Recombinant Macaca fascicularis IL23A&IL12B Heterodimer Protein (Active)

SKU: orb2992165
ActiveBiologically Active

Description

This Recombinant Macaca fascicularis IL23A&IL12B Heterodimer protein spans the amino acid sequence from region 22-189aa&23-328aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Infectious Disease & Virology; Immunology & Inflammation

Images & Validation

Application Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

SourceMammalian cell
Biological OriginMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Biological Activity①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis IL23A&IL12B at 2 μg/mL can bind anti-IL23A&IL12B recombinant antibody. The EC50 is 0.7723-0.9250 ng/mL. ②IL23A&IL12B Recombinant Monoclonal Antibody captured on Protein A Chip can bind Macaca fascicularis IL23A&IL12B with an affinity constant of 0.27 nM as detected by MetaSPR Assay.
TagN-terminal 10xHis-tagged & C-terminal Twin-Strep-tagged
Expression Region22-189aa(IL23A) & 23-328aa(IL12B)
Protein LengthHeterodimer
MW22.1 kDa & 37.8 kDa
PurityGreater than 95% as determined by SDS-PAGE.
Protein SequenceVPGGSSPAWAQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIRQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSPSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP&IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSGEVLGSGKTLTIQVKEFGDAGQYTCHKGGEALSHSLLLLHKKEDGIWSTDVLKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSNPQGVTCGAVTLSAERVRGDNKEYEYSVECQEDSACPAAEERLPIEVMVDAIHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCIQVQGKSKREKKDRIFTDKTSATVICRKNASFSVQAQDRYYSSSWSEWASVPCS

Storage & Handling

StorageThe shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/AppearanceLyophilized powder
Buffer/PreservativesIf the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Recombinant Macaca fascicularis IL23A&IL12B Heterodimer Protein (Active) (orb2992165)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

20 μg
¥ 3,640.00
100 μg
¥ 6,110.00
1 mg
¥ 41,470.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry