You have no items in your shopping cart.
Recombinant Mouse C-C motif chemokine 3 (Ccl3)
SKU: orb2659897
Featured
Description
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 12.0 kDa |
| Expression Region | 24-92aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−Heparin-binding chemotaxis protein;L2G25BMacrophage inflammatory protein 1-alpha ;MIP-1-alpha;SIS-alpha;Small-inducible cytokine A3TY-5
Similar Products
−- Item 1 of 3
Mouse CCL3 [orb3002346]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
Predicted: 10.8 KDa. Observed: 15 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μgRecombinant Mouse CCL3/MIP-1-alpha Protein, N-His-SUMO [orb2964463]
>90% as determined by SDS-PAGE.
20.23 kDa
1 mg, 100 μg, 50 μgMouse Macrophage Inflammatory1 alpha protein [orb754070]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
7.5 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Mouse C-C motif chemokine 3 (Ccl3) (orb2659897)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days