Recombinant Mouse Claudin-6 (Cldn6)-VLPs (Active)

SKU: orb2986425

Active

Description

This Recombinant Mouse Claudin-6 (Cldn6)-VLPs (Active) spans the amino acid sequence from region 1-219aa. Purity: Greater than 95% as determined by SEC-HPLC.

Research Area

Cancer Biology

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Key Properties

−

Source	Mammalian cell
Biological Origin	Mus musculus (Mouse)
Biological Activity	①Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 4.027-6.270 ng/mL. The VLPs is negative control. ②Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 7.349-12.12 ng/mL. The VLPs is negative control.
Tag	C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
Expression Region	1-219aa
Protein Length	Full Length
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.
MW	24.8 kDa
Purity	Greater than 95% as determined by SEC-HPLC.
Protein Sequence	MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Claudin-6; Skullin; Cldn6

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

Q9Z262

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols