Recombinant Mouse IL-2

SKU: orb623195

Description

Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Mouse IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.

Images & Validation

−

Application Notes	The Mouse TNF alpha protein can be used in cell culture, as a TNF alpha ELISA Standard, and as a Western Blot Control.

Key Properties

−

Source	Yeast
Molecular Weight	17.6 kDa
Protein Sequence	APTSSSTSSPTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTF KFYLPKQATELKDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGSDN TFECQFDDESATVVDFLRRWIAFCQSIISTSPQ (153)

Storage & Handling

−

Storage	-20°C
Form/Appearance	Lyophilized
Disclaimer	For research use only

Mouse IL-2 [orb3002463]

Purity:	SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (Regularly tested)
MW:	Predicted: 17.4 KDa. Observed: 17 KDa, reducing conditions

Sizes Available: 10 μg, 50 μg, 1 mg, 500 μg

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols