You have no items in your shopping cart.
Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active)
SKU: orb2986437
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Mouse Ror1 at 2 μg/mL can bind Anti-ROR1 recombinant antibody. The EC50 is 0.8551-0.9363 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Molecular Weight | 44.6 kDa |
| Expression Region | 30-403aa |
| Protein Length | Partial |
| Protein Sequence | QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Disclaimer | For research use only |
Alternative Names
−Inactive tyrosine-protein kinase transmembrane receptor ROR1; mROR1; Neurotrophic tyrosine kinase, receptor-related 1; Ror1; Ntrkr1

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active) (orb2986437)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review