You have no items in your shopping cart.
Recombinant Mouse Tumor necrosis factor receptor superfamily member 5 (Cd40)
Description
Research Area
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | in vitro E.coli expression system |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 10xHis-tagged |
| Molecular Weight | 31.5 kDa |
| Expression Region | 20-289aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQHRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETTDTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMRALLVIPVVMGILITIFGVFLYIKKVVKKPKDNEILPPAARRQDPQEMEDYPGHNTAAPVQETLHGCQPVTQEDGKESRISVQERQVTDSIALRPLV |
| Purity | Greater than 95% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Mouse CD40 [orb2994384]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 46.5 KDa. Observed: 50-58 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman CD40 [orb2994039]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 45.7 KDa. Observed: 50-65 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μgMouse CD40 [orb2994191]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 20.2 KDa. Observed: 22-28 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Mouse CD40/TNFRSF5 Protein, C-His [orb2966238]
ELISA, SDS-PAGE, WB
>95% as determined by SDS-PAGE.
22.39 kDa
1 mg, 50 μg, 100 μgMouse CD40 protein [orb707154]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
50 μg, 10 μg, 500 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Recombinant Mouse Tumor necrosis factor receptor superfamily member 5 (Cd40) (orb2902745)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review