You have no items in your shopping cart.
C22orf28 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human C22orf28 |
| Target | RTCB |
| Protein Sequence | Synthetic peptide located within the following region: PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG |
| Molecular Weight | 55 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−C22orf28 Rabbit Polyclonal Antibody [orb326118]
WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μlC22orf28 Rabbit Polyclonal Antibody [orb2906]
WB
Bovine, Equine, Human, Porcine, Rabbit, Rat, Sheep
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlRTCB Rabbit Polyclonal Antibody [orb2953183]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgC22orf28 Rabbit Polyclonal Antibody (HRP) [orb2102804]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μlC22orf28 Rabbit Polyclonal Antibody (FITC) [orb2102805]
WB
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Rabbit
Polyclonal
FITC
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human 293T, Antibody Dilution: 1.0 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment. Protein may be modified by phosphorylation.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, RTCB is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, RTCB is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-C22orf28 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Colon, Primary antibody Concentration: 10 ug/mL.

Rabbit Anti-C22orf28 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Kidney, Primary antibody Concentration: 10 ug/mL.

Rabbit Anti-RTCB Antibody, Catalog Number: orb326117, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-C22orf28 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.
Documents Download
Request a Document
Protocol Information
C22orf28 Rabbit Polyclonal Antibody (orb326117)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




