You have no items in your shopping cart.
SARS-CoV-2 ORF8/SARS Rabbit Polyclonal Antibody (Fluoro488)
SKU: orb3091680
Description
Research Area
Infectious Disease & Virology, Protein Biochemistry, Signal Transduction
Images & Validation
−
| Dilution Range | Optimal dilutions should be determined by end users. |
|---|---|
| Reactivity | Human |
| Application Notes |
Related Conjugates & Formulations
−Key Properties
−| Antibody Type | Primary Antibody |
|---|---|
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | Rabbit IgG |
| Immunogen | AAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Target | ORF8 protein |
| Molecular Weight | 16693 Da |
| Purification | Immunogen affinity purified. |
| Conjugation | Fluoro488 |
Storage & Handling
−| Storage | At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−ORF8 protein; ORF8; Non-structural protein 8; ns8

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
ORF8 protein
UniProt
UniProt Details
− No UniProt data available