You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC-P, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SEPT11(septin 11) |
| Target | SEPT11 |
| Protein Sequence | Synthetic peptide located within the following region: MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGET |
| Molecular Weight | 49kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Septin 11/SEPTIN11 Rabbit Polyclonal Antibody [orb1402159]
FC, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μgSEP11 rabbit pAb Antibody [orb773072]
ELISA, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlSEPTIN11 Rabbit Polyclonal Antibody [orb395556]
ELISA, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: 1. Human NT-2 cells (60 ug), 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody dilution: 1.0 ug/ml.

Immunohistochemistry with Human Spleen lysate tissue at an antibody concentration of 5.0 ug/ml using anti-SEPT11(septin 11) antibody (orb55705).

SEPT11 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb55705 with 1:200 dilution. Western blot was performed using orb55705 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: SEPT11 IP with orb55705 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-SEPT11(septin 11) Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate.
Documents Download
Request a Document
Protocol Information
SEPT11 Rabbit Polyclonal Antibody (orb55705)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review










