SLC6A11 Rabbit Polyclonal Antibody

SKU: orb331053

Description

SLC6A11 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of SLC6A11. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC6A11. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Neuroscience

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC6A11
Target	SLC6A11
Protein Sequence	Synthetic peptide located within the following region: EGTLPEKLQKLTTPSTDLKMRGKLGVSPRMVTVNDCDAKLKSDGTIAAIT
Molecular Weight	70kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti GAT-3 antibody, anti GAT3 antibody, anti GAT4 antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

Gene Symbol

SLC6A11

UniProt

P48066

RefSeq (Protein):NP_055044

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055044

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols

Applications:	FC, WB
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Applications:	WB
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	HRP

Applications:	FC
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Cy3

Applications:	FC
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Cy5

Applications:	WB
Predicted Reactivity:	Mouse, Rat
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	AP

SLC6A11 Rabbit Polyclonal Antibody

Description

Research Area

Images & Validation

Related Conjugates & Formulations

Key Properties

Storage & Handling

Alternative Names

Similar Products

GABA Transporter 3 Rabbit Polyclonal Antibody [orb156998]

GABA Transporter 3 Rabbit Polyclonal Antibody (HRP) [orb478596]

GABA Transporter 3 Rabbit Polyclonal Antibody (Cy3) [orb986539]

GABA Transporter 3 Rabbit Polyclonal Antibody (Cy5) [orb924700]

GABA Transporter 3 Rabbit Polyclonal Antibody (AP) [orb924671]

Quality Guarantee

Quick Database Links

UniProt Details

NCBI Reference Sequences

Protocol Information

Available Sizes

Email

UK Office

US Office

CN Office

Distributors