Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

SOX5 Rabbit Polyclonal Antibody

SKU: orb329718

Description

Rabbit polyclonal antibody to SOX5

Research Area

Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human SOX5
TargetSOX5
Protein SequenceSynthetic peptide located within the following region: PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYDEEEDDPDVDYG
Molecular Weight84 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti L-SOX5 antibody, anti MGC35153 antibody

Similar Products

  • SOX5 Rabbit Polyclonal Antibody [orb308802]

    WB

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SOX5 Rabbit Polyclonal Antibody (PE) [orb488388]

    ICC,  IF

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    PE

    100 μl
  • SOX5 Rabbit Polyclonal Antibody [orb631421]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SOX5 Rabbit Polyclonal Antibody [orb2955228]

    ELISA,  IHC,  WB

    Human, Mouse, Rat, Xenopus

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • SOX5 Rabbit Polyclonal Antibody [orb329719]

    WB

    Equine, Guinea pig, Mouse, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

SOX5 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The peptide is present in isoforms of 84, 83, 82, 71, and 42 kDa.

SOX5 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/mL.

SOX5 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/mL.

SOX5 Rabbit Polyclonal Antibody

Sample Type: HepG2 cell lysates, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.0 ug/mL, Peptide Concentration: 0.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%.

SOX5 Rabbit Polyclonal Antibody

Positive control (+): THP-1 (N30), Negative control (-): A549 (N03), Antibody concentration: 1 ug/mL.

SOX5 Rabbit Polyclonal Antibody

WB Suggested Anti-SOX5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_821078

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

SOX5 Rabbit Polyclonal Antibody (orb329718)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry