Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

STK3 Rabbit Polyclonal Antibody

SKU: orb580491

Description

Rabbit polyclonal antibody to STK3

Research Area

Cell Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human STK3
TargetSTK3
Protein SequenceSynthetic peptide located within the following region: MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESG
Molecular Weight56kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

KRS1, MST2

Similar Products

  • Phospho-MST4 + MST3 + STK25 (Thr178 + Thr190 + Thr174) Rabbit Polyclonal Antibody [orb185140]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Mst2 Rabbit Polyclonal Antibody [orb157906]

    ICC,  IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • STK3 Rabbit Polyclonal Antibody [orb580492]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • MST3/STK24 Rabbit Polyclonal Antibody [orb1291730]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • MST-3 rabbit pAb Antibody [orb765736]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

STK3 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

STK3 Rabbit Polyclonal Antibody

Lanes: Lane 1: 30 ug of HeLa cell lysate, Lane 2: 30 ug of 293T cell lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

STK3 Rabbit Polyclonal Antibody

Lanes: Lane 1: 100 ug untransfected COS-7 lysate, Lane 2: 100 ug mock transfected Cos-7 lysate, Lane 3: 100 ug STK3 transfected Cos-7 lysate, Lane 4: 50 ug STK3 transfected Cos-7 lysate, Lane 5: 25 ug STK3 transfected Cos-7 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

STK3 Rabbit Polyclonal Antibody

Lanes: Lane 1: 100 ug untransfected RPE-1 lysate, Lane 2: 100 ug untransfected RPE-1 lysate, Lane 3: 100 ug STK3 induced RPE-1 lysate, Lane 4: 100 ug STK3 induced RPE-1 lysate, Primary Antibody dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:5000, Gene Name: STK3.

STK3 Rabbit Polyclonal Antibody

WB Suggested Anti-STK3 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006272

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

STK3 Rabbit Polyclonal Antibody (orb580491)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry