UGT1A7 Rabbit Polyclonal Antibody

SKU: orb580734

Description

Rabbit polyclonal antibody to UGT1A7

Research Area

Cell Biology, Molecular Biology, Signal Transduction

Images & Validation

−

Item 1 of 3

Tested Applications	IHC, WB
Reactivity	Human
Predicted Reactivity	Human

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7
Target	UGT1A7
Protein Sequence	Synthetic peptide located within the following region: VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN
Molecular Weight	57kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

GNT1, UGT1, UDPGT, UGT1A, UGT1G, UGT-1A, UGT-1G, UGT1.1, UGT1.7, UGT1A1, UGT1-01, UGT1-07, hUG-BR1, UDPGT 1-7

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody dilution: 1 ug/ml.

Rabbit Anti-UGT1A7 Antibody, Catalog Number: orb580734, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

WB Suggested Anti-UGT1A7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that UGT1A7 is expressed in 721_B.

Quick Database Links

Gene Symbol

UGT1A7

UniProt

Q5DSZ7

RefSeq (Protein):NP_061950

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_061950

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

IHC

Immunohistochemistry

View Protocol

Find More Protocols