You have no items in your shopping cart.
VIP (human, mouse, rat) . AcOH [RLF-100]
SKU: orb1227501
Featured
Description
Images & Validation
−Item 1 of 1
Key Properties
−| CAS Number | 444827-29-5 | 40077-57-4 (free base) |
|---|---|
| MW | 3325.8 . 60.0 / sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 |
| Purity | greater than or equal to 98% (HPLC) |
| Formula | C147H238N44O42S . C2H4O2 |
| SMILES | O=C([C@H]([C@@H](C)CC)NC([C@H](CO)NC([C@H](CC(N)=O)NC([C@H](CC(C)C)NC([C@H](CC(C=C1)=CC=C1O)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CCSC)NC([C@H](CCC(N)=O)NC([C@H](CCCCN)NC(C(CCCNC(N)=N)NC([C@H](CC(C)C)NC([C@H](CCCNC(N)=N)NC([C@H]([C@@H](C)O)NC([C@H](CC(C=C2)=CC=C2O)NC([C@H](CC(N)=O)NC([C@H](CC(O)=O)NC([C@H]([C@@H](C)O)N([H])C([C@H](CC3=CC=CC=C3)NC([C@H](C(C)C)NC([C@H](C)NC([C@H](CC(O)=O)NC([C@H](CO)NC([C@H](CC4=CN=CN4)N)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)N[C@H](C(N[C@H](C(N)=O)CC(N)=O)=O)CC(C)C.CC(O)=O |
| Solubility | Soluble in water or aqueous solution (1% AcOH) (1mg/ml). |
Storage & Handling
−| Storage | Short Term Storage: +4C. Long Term Storage: -2°C. Handling Advice: Keep cool and dry. Use/Stability: Stable for at least 2 years after receipt when stored at -2°C. |
|---|---|
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Aviptadil; HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2; Vasoactive Intestinal Peptide; Vasoactive Intestinal Octacosapeptide

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Compound Identifiers
PubChem CID
Key Properties
− No computed properties available.
![VIP (human, mouse, rat) . AcOH [RLF-100]](/images/pub/media/catalog/product/NewWebsite/15/orb1227501_1.gif)