Cart summary

You have no items in your shopping cart.

WNT7B Rabbit Polyclonal Antibody

SKU: orb577994

Description

Rabbit polyclonal antibody to WNT7B

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Porcine, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human WNT7B
TargetWNT7B
Protein SequenceSynthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM
Molecular Weight39 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • WNT7B Rabbit Polyclonal Antibody [orb100915]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Gallus, Porcine, Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • WNT7B rabbit pAb Antibody [orb772109]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • WNT7B Rabbit Polyclonal Antibody [orb670332]

    ELISA,  FC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • WNT7B Polyclonal Antibody [orb1417234]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • WNT7B polyclonal antibody [orb647425]

    ELISA,  IF,  IHC,  WB

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WNT7B Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

WNT7B Rabbit Polyclonal Antibody

Anti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody orb577994 concentration 5 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human MKN45 Whole Cell, Antibody Dilution: 5 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

WNT7B Rabbit Polyclonal Antibody

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_478679

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

WNT7B Rabbit Polyclonal Antibody (orb577994)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry