You have no items in your shopping cart.
WNT7B Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human WNT7B |
| Target | WNT7B |
| Protein Sequence | Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
| Molecular Weight | 39 kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−WNT7B Rabbit Polyclonal Antibody [orb100915]
IF, IHC-Fr, IHC-P
Canine, Equine, Gallus, Porcine, Rabbit
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μlWNT7B Polyclonal Antibody [orb1417234]
ELISA, IF, IHC-Fr, IHC-P, WB
Porcine, Rat
Rabbit
Polyclonal
Unconjugated
100 μlWNT7B Rabbit Polyclonal Antibody [orb382125]
WB
Human, Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl, 30 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Anti-WNT7B antibody IHC of human brain, cortex. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. WNT7B Antibody orb577994 concentration 5 ug/ml.

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human MCF7, Antibody Dilution: 1.0 ug/ml.

Sample Tissue: Human MKN45 Whole Cell, Antibody Dilution: 5 ug/ml.

Sample Tissue: Human OVCAR-3 Whole Cell, Antibody Dilution: 1 ug/ml.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 1 ug/ml.

Positive control (+): Hela (HL), Negative control (-): Human lung (LU), Antibody concentration: 1 ug/ml.
Documents Download
Request a Document
Protocol Information
WNT7B Rabbit Polyclonal Antibody (orb577994)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








