Yeast MDR1 protein

SKU: orb246715

Featured

Description

This Yeast MDR1 protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

−

Item 1 of 1

Application Notes	This is His-tag protein

Key Properties

−

Source	Yeast
Biological Origin	Entamoeba histolytica
Tag	N-terminal 6xHis-tagged
Molecular Weight	14.5 kDa
Expression Region	1-114aa
Protein Length	Full Length
Protein Sequence	SGCGKSTTIQLIQRNYEPNGGRVTLDGKDIRELNIKWLRNQIGLVGQEPVLFAGTIRENIMLGAKEGETLSKDEMIECAKMANAHEFVSKLAEGYDTLIGEKGALLSGGQRQRI
Purity	Greater than 90% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

ABC20 protein, ABCB1 protein, ABCB1B protein, CD243 protein, CLCS protein, GP170 protein, IBD13 protein, PGY1 protein, ATP-binding cassette sub-family B member 1 protein, ATP-binding cassette, sub-family B (MDR/TAP), member 1 protein, CD243 antigen protein, colchicin sensitivity protein, doxorubicin resistance protein, multidrug resistance protein 1 protein, P-glycoprotein 1 protein, P-gp protein, PGY1P-GP protein, ATP binding cassette, sub family B (MDR/TAP), member 1 protein, MDR1 protein, MDR 1 protein, Multidrug resistance 1 protein, P glycoprotein 1 protein, P gp protein

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P16875

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols