Yeast RPB5 protein

SKU: orb605167

Featured

Description

This Yeast RPB5 protein spans the amino acid sequence from region 1-215aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Epigenetics & Chromatin

Images & Validation

−

Item 1 of 1

Application Notes	Full Length

Key Properties

−

Source	E.coli
Biological Origin	Kluyveromyces marxianus (Yeast) (Candida kefyr)
Tag	N-terminal 6xHis-tagged
Molecular Weight	29.0 kDa
Expression Region	1-215aa
Protein Length	Full Length
Protein Sequence	MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL
Purity	Greater than 85% as determined by SDS-PAGE.

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Disclaimer	For research use only

Alternative Names

−

RPB5, DNA-directed RNA polymerases I, II, and III subunit RPABC1, RNA polymerases I, II, and III subunit ABC1

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

Q9P4B9

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols