Cart summary

You have no items in your shopping cart.

YTHDF1 Rabbit Polyclonal Antibody

SKU: orb583420

Description

Rabbit polyclonal antibody to YTHDF1

Research Area

Epigenetics, Immunology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityCanine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human YTHDF1
TargetYTHDF1
Protein SequenceSynthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA
Molecular Weight61 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

DF1, C20orf21

Similar Products

  • YTHDF1 Rabbit Polyclonal Antibody [orb632665]

    ELISA,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • YTHDF1 Antibody [orb683706]

    ELISA,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • YTHDF1 Antibody [orb670802]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Ythdf1 Rabbit Polyclonal Antibody [orb583419]

    WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

    Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • DACA-1 Polyclonal Antibody [orb1414024]

    IHC-P,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 3 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human Jurkat Whole Cell, Antibody dilution: 2 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1.0 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody dilution: 1 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Sample Tissue: Human U937 Whole Cell, Antibody dilution: 1 ug/ml.

YTHDF1 Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

YTHDF1 Rabbit Polyclonal Antibody

WB Suggested Anti-YTHDF1 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate. YTHDF1 is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_060268

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

YTHDF1 Rabbit Polyclonal Antibody (orb583420)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry