Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ZEB2 Rabbit Polyclonal Antibody

SKU: orb330041

Description

Rabbit polyclonal antibody to ZEB2

Research Area

Epigenetics & Chromatin, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Porcine, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZEB2
TargetZEB2
Protein SequenceSynthetic peptide located within the following region: LGRQDGDEEFEEEEEESENKSMDTDPETIRDEEETGDHSMDDSSEDGKME
Molecular Weight25 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti KIAA0569 antibody, anti SIP-1 antibody, anti SIP1 antibody, anti SMADIP1 antibody, anti ZFHX1B antibody, anti HSPC082 antibody

Similar Products

  • ZEB2 Rabbit Polyclonal Antibody [orb329735]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • Smad Interacting Protein 1/ZEB2 Rabbit Polyclonal Antibody [orb215990]

    FC,  ICC,  IHC,  IHC-Fr,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • SIP1 rabbit pAb Antibody [orb766320]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • SIP1 Rabbit Polyclonal Antibody [orb1919]

    IF,  IHC-Fr,  IHC-P

    Canine, Equine, Gallus, Human

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • ZEB2 Antibody [orb684932]

    ELISA,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ZEB2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 0.4 ug/mL of the antibody was used in this experiment. The protein may be modfied by glycosylation and phosphorylation.

ZEB2 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.

ZEB2 Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody Dilution: 1 ug/mL.

ZEB2 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

ZEB2 Rabbit Polyclonal Antibody

IHC Information: Paraffin embedded small intestine, myenteric plexus tissue, tested with an antibody Dilution of 2.5 ug/mL.

ZEB2 Rabbit Polyclonal Antibody

WB Suggested Anti-ZEB2 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Hela cell lysate.

ZEB2 Rabbit Polyclonal Antibody

ZEB2 antibody - middle region (orb330041) validated by WB using H9 human embryonic stem cells at 1:1000.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_055610

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

ZEB2 Rabbit Polyclonal Antibody (orb330041)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry