Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ZNF341 Antibody - middle region Discontinued

SKU: orb2276184

Description

ZNF341 Antibody - middle region is an unconjugated, affinity purified antibody. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human ZNF341. This antibody reacts with Human samples. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human ZNF341
Protein SequenceSynthetic peptide located within the following region: GEEEGDKPESKQVVLIDSSYLCQFCPSKFSTYFQLKSHMTQHKNEQVYKC
Molecular Weight92kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HIES3
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_116208

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

Yaoyi Li 1, Yingliang Sheng 2, Chao Di 3, Hongjie Yao Base-pair resolution reveals clustered R-loops and DNA damage-susceptible R-loops Base-pair resolution reveals clustered R-loops and DNA damage-susceptible R-loops, Mol Cell ., (2025)

Available Sizes

Select a size below

25 μl
$ 200.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 5-10 working days
Bulk Enquiry