Bone Morphogenetic Protein 4, BMP4

SKU: orb3148691

Featured

Description

Recombinant mature human BMP4 is produced in HEK293 cells using stable mammalian expression. This tag-free, liquid-formulated, research-grade protein is purified through a gentle mixed-mode chromatography process designed to preserve its native structure and biological activity. It is suitable for stem cell differentiation, developmental biology, organoid workflows, lineage specification, and media development applications. (Tested applications: Functional studies, ImmunoAssay, Western Blot.)

Research Area

Stem Cell & Developmental Biology; Musculoskeletal & Connective Tissue Research

Images & Validation

−

Item 1 of 2

Tested Applications

FA, WB

Application Notes

Biologically active and independently validated against human BMP4 from R&D Systems in two differentiation models. 1. In a cardiac differentiation model, Daresbury BMP4 supported beating embryoid body formation and NKX2.5-GFP expression at 11 ng/mL, compared with 25 ng/mL for the commercial reference under the reported conditions. 2. In day-5 trophoblast differentiation of MAN13 hESCs at 10 ng/mL, this product induced CDX2, GATA3, KRT7, and TFAP2A expression by 1540-, 2350-, 7.69-, and 4542-fold, respectively, relative to the untreated control (= 1). These responses corresponded to approximately 90%, 122%, 88%, and 88% of the R&D Systems reference response, respectively.

Key Properties

−

Expression System	HEK293 Cells
Biological Origin	Human
Tag	No tag
Molecular Weight	13 kDa
Expression Region	293-408 aa
Protein Sequence	SPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Purification	Mixed-mode chromatography
Purity	>95%

Storage & Handling

−

Storage	4°C for short-term and -70°/80°C long-term
Form/Appearance	Liquid (Sterile-filtered)
Buffer/Preservatives	20mM histidine pH 5.5, 0.2M NaCl, 0.6M arginine
Expiration Date	6 months from date of receipt.
Dry Ice Shipping	Please note: This product requires shipment on dry ice. A dry ice surcharge will apply.
Disclaimer	For research use only

Alternative Names

−

Bone Morphogenetic Protein 4, BMP4, BMP-4, BMP2B, BMP-2B, ZYME, DVR4

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

1. MW (NEB P7719) 5uL. 2. BMP4 2ug. 3. BMP4 4ug.

1. BMP4 Reducing. 2. MW (NEB P7719) 5uL. 3. 175V for 45minutes (Biorad Mini-Protean TGX 4-20%, 10well 50uL). Gel samples were made 50uL sample + 10ul 6x(NON) reducing Laemmli. Loading aiming for ~2ug.

Quick Database Links

UniProt

P12644

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols