Cart summary

You have no items in your shopping cart.

CASP1 Rabbit Polyclonal Antibody

SKU: orb333727

Description

Rabbit polyclonal antibody to Caspase 1

Research Area

Cell Biology, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityEquine, Rabbit, Yeast

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CASP1
TargetCASP1
Protein SequenceSynthetic peptide located within the following region: LQTRVLNKEEMEKVKRENATVMDKTRALIDSVIPKGAQACQICITYICEE
Molecular Weight10kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CASP-1 antibody, anti CASP1 antibody, anti Caspase 1 antibody, anti Caspase-1 subunit p10 antibody, anti ICE antibody, anti IL-1 beta-converting enzyme antibody, anti IL-1BC antibody, anti IL1 beta converting enzyme antibody, anti IL1B convertase antibody, anti Interleukin 1 beta convertase antibody, anti Interleukin 1B converting enzyme antibody, anti Interleukin-1 beta convertase antibody, anti Interleukin-1 beta-converting enzyme antibody, anti p45 antibody

Similar Products

  • Caspase-1 P10 Rabbit Polyclonal Antibody [orb10232]

    FC,  IF,  IHC-Fr,  IHC-P

    Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • Caspase-1 p20 Rabbit Polyclonal Antibody [orb317579]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • Caspase-1 p20 Rabbit Polyclonal Antibody [orb221355]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Caspase-1 P10 Rabbit Polyclonal Antibody [orb500778]

    FC,  WB

    Mouse

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Cleaved-Caspase-1 p20 (D210) rabbit pAb Antibody [orb770550]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CASP1 Rabbit Polyclonal Antibody

Rabbit Anti-CASP1 Antibody, Catalog Number: orb333727, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:600, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

CASP1 Rabbit Polyclonal Antibody

WB Suggested Anti-CASP1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate, CASP1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001214

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CASP1 Rabbit Polyclonal Antibody (orb333727)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry