Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CHRFAM7A Rabbit Polyclonal Antibody

SKU: orb329831

Description

CHRFAM7A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CHRFAM7A. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human CHRFAM7A. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Molecular Biology, Pharmacology & Drug Discovery, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CHRFAM7A
TargetCHRFAM7A
Protein SequenceSynthetic peptide located within the following region: QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
Molecular Weight35kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Anti-Alpha 7 neuronal nicotinic acetylcholine receptor FAM7A hybrid antibody, anti-CHRNA7 (cholinergic receptor nicotinic alpha 7 exons 5 10) and FAM7A (family with sequence similarity 7A exons A E) fusion antibody, anti-CHRNA7 antibody, anti-CHRNA7 DR1 antibody, anti-CHRNA7 FAM7A fusion antibody, anti-CHRNA7 FAM7A fusion protein antibody, anti-D 10 antibody,anti-D10 antibody, anti-MGC120482 antibody, anti-MGC120483 antibody

Similar Products

  • CHRFAM7A Rabbit Polyclonal Antibody [orb625783]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CHRNA7 Rabbit Polyclonal Antibody [orb625789]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CHRFAM7A Rabbit Polyclonal Antibody [orb341371]

    IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl, 30 μl
  • CHRFAM7A Antibody (C-Term) [orb1926069]

    WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CHRFAM7A Rabbit Polyclonal Antibody [orb329832]

    WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CHRFAM7A Rabbit Polyclonal Antibody

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

CHRFAM7A Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody Dilution: 1.0 ug/mL, CHRFAM7A is supported by BioGPS gene expression data to be expressed in 721_B.

CHRFAM7A Rabbit Polyclonal Antibody

WB Suggested Anti-CHRFAM7A Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, CHRFAM7A is supported by BioGPS gene expression data to be expressed in HEK293T.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_683709

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CHRFAM7A Rabbit Polyclonal Antibody (orb329831)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry