Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CYP11B1 Rabbit Polyclonal Antibody

SKU: orb584585

Description

CYP11B1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CYP11B1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1. This antibody reacts with Human, Monkey samples and is predicted to react with Porcine, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Metabolism Research

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Monkey
Predicted ReactivityPorcine, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1
TargetCYP11B1
Protein SequenceSynthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL
Molecular Weight58 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FHI, CPN1, CYP11B, P450C11

Similar Products

  • CYP11B1 Rabbit Polyclonal Antibody [orb5937]

    ICC,  IF,  IHC-P,  WB

    Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CYP11B1 Rabbit Polyclonal Antibody [orb783391]

    WB

    Human, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CYP11B1/2 rabbit pAb Antibody [orb766829]

    ELISA,  WB

    Human

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CYP11B1/2 rabbit pAb Antibody [orb764966]

    ELISA,  WB

    Human

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CYP11B1 Rabbit Polyclonal Antibody [orb500751]

    WB

    Bovine, Canine, Equine, Porcine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CYP11B1 Rabbit Polyclonal Antibody

Sample type: 1. HEK293TN-GFP-hcyp11B1 (75 ug), 2. HEK293TN-GFP-hcyp11B2 (75 ug), Primary dilution: 1:100, Secondary Antibody: mouse anti-Rabbit HRP, Secondary dilution: 1:10000, Film Exposed for: 5 minutes.

CYP11B1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

CYP11B1 Rabbit Polyclonal Antibody

Sample Tissue: Human HepG2 Whole Cell, Antibody dilution: 1 ug/ml.

CYP11B1 Rabbit Polyclonal Antibody

Sample Type: Monkey adrenal gland, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.

CYP11B1 Rabbit Polyclonal Antibody

Sample Type: Monkey vagina, Primary Antibody dilution: 1:25, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:1000, Color/Signal Descriptions: Brown: CYP11B1 Blue: Nucleus, Gene Name: CYP11B1.

CYP11B1 Rabbit Polyclonal Antibody

WB Suggested Anti-CYP11B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_000488

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

CYP11B1 Rabbit Polyclonal Antibody (orb584585)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry