Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EIF3E Rabbit Polyclonal Antibody

SKU: orb330533

Description

EIF3E Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EIF3E. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human EIF3E. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Infectious Disease & Virology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EIF3E
TargetEIF3E
Protein SequenceSynthetic peptide located within the following region: LNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK
Molecular Weight52kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti EIF3-P48 antibody, anti EIF3S6 antibody, anti INT6 antibody, anti eIF3-p46 antibody

Similar Products

  • EIF3E Rabbit Polyclonal Antibody [orb865505]

    ELISA,  FC,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • EIF3E Antibody(Center) [orb1932339]

    WB

    Mouse, Other, Rat

    Human, Zebrafish

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • EIF3E Rabbit Polyclonal Antibody [orb330532]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • EIF3E Rabbit Polyclonal Antibody [orb626674]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • EIF3E Rabbit Polyclonal Antibody [orb626675]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EIF3E Rabbit Polyclonal Antibody

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

EIF3E Rabbit Polyclonal Antibody

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

EIF3E Rabbit Polyclonal Antibody

Rabbit Anti-EIF3E Antibody, Catalog Number: orb330533, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

EIF3E Rabbit Polyclonal Antibody

Sample Type: 1. B8 mouse fibroblast cells, extraction only2. Human total cell extractPrimary dilution: 1:1000, Secondary Anitbody: HRP conjugated anti-rabbit.

EIF3E Rabbit Polyclonal Antibody

WB Suggested Anti-EIF3E Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001559

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

EIF3E Rabbit Polyclonal Antibody (orb330533)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry