Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GNL3L Rabbit Polyclonal Antibody

SKU: orb584120

Description

GNL3L Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of GNL3L. It is suitable for IF, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

Tested ApplicationsIF, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human GNL3L
TargetGNL3L
Protein SequenceSynthetic peptide located within the following region: QQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT
Molecular Weight66 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

GNL3B

Similar Products

  • GNL3L rabbit pAb Antibody [orb765317]

    ELISA,  IF,  IHC,  WB

    Feline, Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • GNL3L Rabbit Polyclonal Antibody [orb157230]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Human, Porcine, Rabbit

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • GNL3L Antibody [orb676135]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg, 50 μg
  • GNL3L Antibody (N-term) [orb1439620]

    FC,  WB

    Mouse

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • GNL3L Rabbit Polyclonal Antibody [orb256565]

    IHC,  WB

    Bovine, Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GNL3L Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. The isoforms of 66 kDa and 57 kDa are identified in a subset of these samples.

GNL3L Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Peptide is contained within a 66 kDa isoform as well as a 57 kDa isoform. Protein may be sumoylated.

GNL3L Rabbit Polyclonal Antibody

Sample Type: 721_B, Antibody dilution: 1.0 ug/ml. GNL3L is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

GNL3L Rabbit Polyclonal Antibody

Sample Type: HeLa, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: GNL3L.

GNL3L Rabbit Polyclonal Antibody

WB Suggested Anti-GNL3L Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human Lung.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_061940

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IF
Immunofluorescence
View Protocol

GNL3L Rabbit Polyclonal Antibody (orb584120)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry