Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

GRB2 Rabbit Polyclonal Antibody

SKU: orb584010

Description

Rabbit polyclonal antibody to GRB2

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetGRB2
Protein SequenceSynthetic peptide located within the following region: AKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIE
Molecular Weight24kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ASH, Grb3-3, MST084, NCKAP2, MSTP084, EGFRBP-GRB2

Similar Products

  • SH3GL2 Rabbit Polyclonal Antibody [orb865464]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Gads rabbit pAb Antibody [orb765267]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • Gab 1 (phospho Tyr659) rabbit pAb Antibody [orb768297]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • GAB2 Rabbit Polyclonal Antibody [orb1676486]

    ELISA,  FC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • GRB2 rabbit pAb Antibody [orb768505]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

GRB2 Rabbit Polyclonal Antibody

Sample Type: 2. mouse brain extracts (80 ug), Primary Antibody dilution: 2 ug/ml, Secondary Antibody: IRDye 800CW goat anti-rabbit, Secondary Antibody dilution: 1:20000.

GRB2 Rabbit Polyclonal Antibody

GRB2 antibody - N-terminal region (orb584010) validated by WB using 1. and 2. Human Cystic Fibrosis Bronchial Epithelial Cells (35 ug) Primary dilution: 1:500, Secondary Anitbody: goat anti-rabbit-HRPSecondary dilution: 1:5000.

GRB2 Rabbit Polyclonal Antibody

GRB2 antibody - N-terminal region (orb584010) validated by WB using 721_B cell Lysate at 1 ug/ml. GRB2 is supported by BioGPS gene expression data to be expressed in 721_B.

GRB2 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

GRB2 Rabbit Polyclonal Antibody

Rabbit Anti-GRB2 Antibody, Catalog Number: orb584010, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002077

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

GRB2 Rabbit Polyclonal Antibody (orb584010)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry