Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HIF1a Antibody

SKU: orb153330

Description

Goat polyclonal to alpha subunit of transcription factor hypoxia-inducible factor-1 (HIF-1), which is a heterodimer composed of an alpha and a beta subunit. HIF-1 functions as a master regulator of cellular and systemic homeostatic response to hypoxia by activating transcription of many genes, including those involved in apoptosis, angiogenesis, energy metabolism, and other genes whose protein products increase oxygen delivery or facilitate metabolic adaptation to hypoxia. HIF-1 thus plays an essential role in tumour angiogenesis, embryonic vascularization, and pathophysiology of ischemic disease.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:500-1:2,000
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. Antigen Sequence: LLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
TargetHypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor)
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

alpha subunit (basic helix-loop-helix transcription factor), ARNT interacting protein, basic-helix-loop-helix-PAS protein MOP1, bHLHe78, class E basic helix-loop-helix protein 78, HIF-1alpha, HIF1, HIF1-ALPHA, HIF1a, hypoxia inducible factor 1, hypoxia-inducible factor 1 alpha isoform I.3, hypoxia-inducible factor 1, hypoxia-inducible factor 1-alpha, member of PAS protein 1, member of PAS superfamily 1, MOP1, PASD8, PAS domain-containing protein 8 antibody.

Similar Products

  • HIF-1 Alpha Rabbit Polyclonal Antibody [orb500810]

    FC,  ICC

    Gallus, Porcine

    Human

    Rabbit

    Polyclonal

    Unconjugated

    200 μl, 50 μl, 100 μl
  • HIF-1 Alpha Rabbit Polyclonal Antibody [orb500743]

    FC,  WB

    Gallus, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • HIF1A Antibody [orb1930780]

    FC,  IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • HIF1Alpha Antibody (Center) [orb1928917]

    FC,  IF,  IHC-P,  WB

    Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • HIF-1 alpha/HIF1A/HIF Rabbit Polyclonal Antibody [orb669094]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HIF1a Antibody

Western blot analysis of 293 cell line lysate and MBP-HIF1 alpha recombinant protein using HIF1a antibody.

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

HIF1a Antibody (orb153330)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
¥ 3,640.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry