Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

HSPH1 Rabbit Polyclonal Antibody

SKU: orb581618

Description

HSPH1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of HSPH1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human HSPH1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HSPH1
TargetHSPH1
Protein SequenceSynthetic peptide located within the following region: EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ
Molecular Weight97kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HSP105, HSP105A, HSP105B, NY-CO-25

Similar Products

  • Hsp105/HSPH1 Rabbit Polyclonal Antibody [orb443112]

    ELISA,  FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HSP105 rabbit pAb Antibody [orb765455]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Hsp105/HSPH1 Rabbit Polyclonal Antibody [orb76122]

    FC,  ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • HSPH1 Antibody (Center) [orb1931387]

    FC,  IHC-P,  WB

    Hamster, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • HSPH1 Rabbit Polyclonal Antibody [orb215017]

    IF,  IH,  KO/KD Validated,  WB

    Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

HSPH1 Rabbit Polyclonal Antibody

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. HSPH1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

HSPH1 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

HSPH1 Rabbit Polyclonal Antibody

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. HSPH1 is strongly supported by BioGPS gene expression data to be expressed in MCF7.

HSPH1 Rabbit Polyclonal Antibody

Rabbit Anti-HSPH1 Antibody, Catalog Number: orb581618, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in endothelial cells in sinusoids, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

HSPH1 Rabbit Polyclonal Antibody

WB Suggested Anti-HSPH1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006635

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

HSPH1 Rabbit Polyclonal Antibody (orb581618)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry