You have no items in your shopping cart.
Featured
Active
Description
Research Area
Signal Transduction
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human Activin A at 2μg/ml can bind Human ACVR2B-Fc-His, the ED50 of Recombinant Human ACVR2B-Fc-His is 50-500 ng/ml. |
| Tag | C-terminal 6xHis-Fc-tagged |
| Expression Region | 19-134aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 41.3 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 10% Trehalose, 3% Mannitol, 0.05% Tween 80, 10 mM Methionine, pH 8.5. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Activin Receptor Type-2B; Activin Receptor Type IIB; ACTR-IIB; ACVR2B
Similar Products
−
Recombinant Human ACVR2B Protein [orb2995160]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 14.37 KDa. Observed: 25-38 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human ACVR2B Protein [orb2993980]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 41.3 KDa. Observed: 60 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 3
ACVR2B Antibody [orb518602]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
Recombinant Human ACVR2B Protein, N-His [orb3150058]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
15.62 kDa
50 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human ACVR2B protein (orb594924)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks