You have no items in your shopping cart.
Human CD40 protein
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 48 kDa |
| Expression Region | 21-193aa |
| Protein Length | Partial |
| Protein Sequence | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| Purity | Greater than 92% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Human CD40LG protein [orb705340]
Greater than 87% as determined by SDS-PAGE.
44.5 kDa
Mammalian cell
1 mg, 20 μg, 100 μgHuman CD40L [orb2995248]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 16.2 kDa. Observed: 15 kDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman CD40L [orb2994033]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 19.1 KDa. Observed: 19-22 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman CD40L [orb2994532]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 95% as determined by SEC-HPLC. (QC verified)
Predicted: 16.2 KDa. Observed: 16-18 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgHuman CD40L [orb2993921]
Unconjugated
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.
Predicted: 42.7 KDa. Observed: 50&90 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD40 at 2 μg/ml can bind CD40L, the EC50 is 3.112-3.858 ng/ml.

Human CD40 protein hFc tag captured on COOH chip can bind Human CD40L protein hFc and Flag tag with an affinity constant of 2.06 nM as detected by LSPR Assay.

The purity of CD40 was greater than 95% as determined by SEC-HPLC
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human CD40 protein (orb705123)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review



