You have no items in your shopping cart.
Human FGF-19 protein
SKU: orb245287
Featured
Description
Research Area
Signal Transduction
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Molecular Weight | 47.8 kDa |
| Expression Region | 32-216aa |
| Protein Length | Partial |
| Protein Sequence | PHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Disclaimer | For research use only |
Alternative Names
−FGF-19, FGF19 , UNQ334, PRO533 19
Similar Products
−- Item 1 of 2
- Item 1 of 1
Human FGF19 protein (Active) [orb359157]
> 95% as determined by SDS-PAGE and HPLC.
21.8 kDa
E.Coli
5 μg, 100 μg, 500 μg 
Recombinant Human FGF19 Protein, N-His [orb2961544]
>90% as determined by SDS-PAGE.
25.94 kDa
1 mg, 100 μg, 50 μgRecombinant Human FGF19 Protein, N-His tag [orb2966246]
>90% as determined by SDS-PAGE.
23.54 kDa
1 mg, 100 μg, 50 μg- Item 1 of 1
Human FGF-19 (N-6His) Protein [orb1471725]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
23.5 KDa
Mammalian
50 μg, 10 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human FGF-19 protein (orb245287)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks