Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Human IL 1 beta (His) Protein

SKU: orb426418

Description

Recombinant of human IL 1 beta (His) protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceEscherichia Coli
PurityGreater than 95.0% as determined by SDS-PAGE.
Protein SequenceAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFV QGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKME KRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Storage & Handling

StorageStability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles
Form/AppearanceSterile Filtered clear solution.
Buffer/PreservativesIL-1b His tag protein solution is supplied in 20mM Tris-HCl pH 8.0 and 50% glycerol.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Similar Products

  • Recombinant Human CD218b/IL18RAP Protein, N-His [orb2966844]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    40.74 kDa

    1 mg, 50 μg, 100 μg
  • Recombinant Human CASP1/Caspase-1 Protein, N-His [orb2968759]

    ELISA,  SDS-PAGE,  WB

    >90% as determined by SDS-PAGE.

    22.14 kDa

    1 mg, 50 μg, 100 μg
  • Human IL-1 beta Protein, His Tag [orb762423]

    Unconjugated

    95%

    19.4 kDa

    50 μg, 20 μg, 1 mg
  • Human IL-12 R beta 1 Protein, His Tag [orb570283]

    Unconjugated

    90%

    59.0 kDa

    1 mg, 100 μg
  • Recombinant human IL-1b protein, C-His [orb1516901]

    >95% as determined by SDS-PAGE

    17 kDa

    100 μg, 500 μg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Human IL 1 beta (His) Protein (orb426418)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 250.00
20 μg
$ 350.00
1 mg
$ 7,440.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry