You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 2
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL. |
| Tag | N-terminal 6xHis-tagged |
| Expression Region | 20-104aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 11.1 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−LY6G6D
Similar Products
−- Item 1 of 3
- Item 1 of 2
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial [orb1785279]
Greater than 90% as determined by SDS-PAGE.
38.0 kDa
Mammalian cell
1 mg, 100 μg, 20 μg - Item 1 of 1
Linclatamig Human Monoclonal Antibody [orb2976177]
ELISA, FA, FACS, In vivo
Human
Human Humanized
Monoclonal
Unconjugated
100 μg, 1 mg - Item 1 of 1
LY6G6D/MEGT1 Human Monoclonal Antibody [orb2976498]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mg - Item 1 of 1
LY6G6D/MEGT1 Human Monoclonal Antibody [orb2976355]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human LY6G6D at 2 μg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 2.816-3.741 ng/mL.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human LY6G6D protein (orb245910)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks