You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody, the EC50 is 0.9057-1.259 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 4131-4390aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 32.0 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | RTTTCFGDGCQNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFTEELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPEYKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKMAKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGETCNQGTQKSL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−Recombinant Human Mucin-17 Protein [orb2992849]
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 56.2 KDa. Observed: (17-28)&(50-75) KDa, reducing conditions
500 μg, 1 mg, 10 μg, 50 μgRecombinant Human Mucin-17 Protein [orb2992994]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 30.1 kDa. Observed: 45-55&25-30&17-21 kDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgMUC17 Mouse Monoclonal Antibody [orb2974452]
ELISA, FC
Human
Mouse
Monoclonal
Unconjugated
50 μg, 100 μgRecombinant Human MUC17 Protein, N-His [orb2967737]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
49.74 kDa
1 mg, 50 μg, 100 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human MUC17 at 2 μg/mL can bind Anti-MUC17 recombinant antibody, the EC50 is 0.9057-1.259 ng/mL.
Quick Database Links
UniProt Details
−Documents Download
Request a Document
Protocol Information
Human MUC17 Protein (orb1476712)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review


