You have no items in your shopping cart.
Human Novel Coronavirus Spike glycoprotein(S) protein
SKU: orb668858
Featured
Description
Research Area
Microbiology
Images & Validation
−
Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Yeast |
|---|---|
| Biological Origin | Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2) |
| Tag | N-terminal 6xHis-sumostar-tagged |
| Expression Region | 16-685aa |
| Protein Length | Partial |
| MW | 88.1 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−E2 Peplomer protein
Similar Products
−- Item 1 of 6
Human Novel Coronavirus Spike glycoprotein(S) protein [orb668860]
Greater than 90% as determined by SDS-PAGE.
30.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μg - Item 1 of 3
Human Novel Coronavirus Spike glycoprotein(S) protein [orb668864]
Greater than 90% as determined by SDS-PAGE.
27.8 kDa
Mammalian cell
1 mg, 100 μg, 20 μg - Item 1 of 3
Human Novel Coronavirus Spike glycoprotein(S) protein (Biotin) [orb668865]
Greater than 90% as determined by SDS-PAGE.
54.1 kDa
Mammalian cell
1 mg, 100 μg, 20 μg - Item 1 of 2
Human Novel Coronavirus Spike glycoprotein(S) protein [orb668861]
Greater than 90% as determined by SDS-PAGE.
27.9 kDa
Mammalian cell
1 mg, 100 μg, 20 μg - Item 1 of 2
Human Novel Coronavirus Spike glycoprotein(S) protein [orb668862]
Greater than 90% as determined by SDS-PAGE.
30.2 kDa
Mammalian cell
1 mg, 100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks