Human SPRC protein

SKU: orb419320

This product can be custom made

Featured

Active

Description

This Human SPRC protein spans the amino acid sequence from region 18-303aa. Purity: > 98% as determined by SDS-PAGE and HPLC.

Research Area

Cancer Biology

Images & Validation

−

Item 1 of 1

Application Notes	Tag Info: NO-taggedExpression Region: 18-297aaSequence Info: Full Length of Isoform PlGF-2

Key Properties

−

Source	E.Coli
Biological Origin	Homo sapiens (Human)
Biological Activity	Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the cell growth of Mv1Lu mink lung epithelial cells is less than 3.0 µg/mL, corresponding to a specific activity of > 333 IU/mg.
Tag	Tag-Free
Expression Region	18-303aa
Protein Length	Partial
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.
MW	32.7 kDa
Purity	> 98% as determined by SDS-PAGE and HPLC.
Protein Sequence	APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 µm filtered PBS, pH 7.4
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Basement-membrane protein 40, Osteonectin, ON, Secreted protein acidic and rich in cysteine,

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB analysis of orb419320.

Quick Database Links

UniProt

P09486

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols