You have no items in your shopping cart.
Human THPO protein
SKU: orb594751
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The ED50 as determined in a cell proliferation assay using MO7E human megakaryocytic leukemic cells is 0.55 ng/ml. |
| Tag | N-terminal 6xHis-tagged and C-terminal 6xHis-tagged |
| Molecular Weight | 37.3 kDa |
| Expression Region | 22-353aa |
| Protein Length | Full Length of Mature Protein |
| Protein Sequence | SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Thrombopoietin;C-mpl ligand;Megakaryocyte colony-stimulating factor;Megakaryocyte growth and development factor;Myeloproliferative leukemia virus oncogene ligand;THPO
Similar Products
−- Item 1 of 1
Human THPO protein [orb604411]
Greater than 85% as determined by SDS-PAGE.
34.7 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
Recombinant human TPO protein (Active, HEK293) [orb1817180]
>95% as determined by SDS-PAGE
80-85 kDa
10 μg, 50 μg, 100 μg - Item 1 of 1
Human TPO (N, C-6His) Protein [orb1471766]
Unconjugated
Greater than 95% as determined by reducing SDS-PAGE.
37.3 KDa
Mammalian
50 μg, 10 μg 
Recombinant Human THPO Protein, C-His [orb2968590]
>90% as determined by SDS-PAGE.
38.74 kDa
1 mg, 100 μg, 50 μgRecombinant Human THPO Protein, N-GST [orb2968591]
>90% as determined by SDS-PAGE.
55.77 kDa
1 mg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human THPO protein (orb594751)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks