Human ULBP1 protein

SKU: orb705332

This product can be custom made

Featured

Active

Description

This Human ULBP1 protein spans the amino acid sequence from region 26-216aa. Purity: Greater than 93% as determined by SDS-PAGE.

Research Area

Cell Biology

Images & Validation

−

Item 1 of 3

Application Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

−

Source	Mammalian cell
Biological Origin	Homo sapiens (Human)
Biological Activity	①Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml. ②Human KLRK1 protein Fc tag captured on COOH chip can bind Human ULBP1 protein Fc/myc tag with an affinity constant of 2.27 nM as detected by LSPR Assay.
Tag	C-terminal hFc1-Myc-tagged
Expression Region	26-216aa
Protein Length	Full Length of Mature Protein
Endotoxins	Less than 1.0 EU/μg as determined by LAL method.
MW	52.4 kDa
Purity	Greater than 93% as determined by SDS-PAGE.
Protein Sequence	GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Lyophilized powder
Buffer/Preservatives	Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

(ALCAN-beta) (NKG2D ligand 1) (N2DL-1) (NKG2DL1) (Retinoic acid early transcript 1I)

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized KLRK1 at 10 μg/ml can bind human ULBP1, the EC50 of human ULBP1 protein is 228.5-427.6 ng/ml.

Human KLRK1 protein Fc tag captured on COOH chip can bind Human ULBP1 protein Fc/myc tag with an affinity constant of 2.27 nM as detected by LSPR Assay.

Quick Database Links

UniProt

Q9BZM6

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols