You have no items in your shopping cart.
Mouse Il1rl2 protein
SKU: orb358849
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Mus musculus (Mouse) |
| Tag | N-terminal 6xHis-tagged |
| Molecular Weight | 40 kDa |
| Expression Region | 22-338aa |
| Protein Length | Partial |
| Protein Sequence | DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCALDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR |
| Purity | Greater than 90% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−IL-36 receptor Interleukin-1 receptor-related protein 2 Short name, IL-1Rrp2 Short name, IL1R-rp2
Similar Products
−
Recombinant Mouse IL-1RL2 Protein [orb2993889]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 36.9 KDa. Observed: 50-70 KDa, reducing conditions
50 μg, 500 μg, 1 mg, 10 μgRecombinant Mouse IL-1RL2 Protein [orb2993925]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 62.97 KDa. Observed: 85-120 KDa, reducing conditions
10 μg, 50 μg, 1 mg, 500 μg- Item 1 of 1
Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial [orb2658532]
Greater than 95% as determined by SDS-PAGE.
42.9 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Recombinant Mouse Interleukin-1 receptor-like 2 (Il1rl2), partial [orb2659343]
Greater than 90% as determined by SDS-PAGE.
49.0 kDa
E.coli
20 μg, 1 mg, 100 μg 
IL1RL2/IL-36R Rabbit Polyclonal Antibody [orb2951678]
ELISA, IHC, WB
Mouse
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Mouse Il1rl2 protein (orb358849)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks