Parathyroid hormone (1-34) (human)

SKU: orb1147059

Description

Parathyroid hormone receptor agonist; Peptides.

Research Area

Metabolism Research

Images & Validation

−

Key Properties

−

Molecular Weight	4117.77 Da
Protein Sequence	H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Purity	> 95%

Storage & Handling

−

Storage	Store in the dark, frozen and dessicated
Form/Appearance	Freeze fried solid
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

52232-67-4, Human parathyroid hormone (1-34)PTH 1-34, Parathyroid hormone (1-34) (human), SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, Teriparatide, hPTH (1-34)

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols