Cart summary

You have no items in your shopping cart.

PCBP1 Rabbit Polyclonal Antibody

SKU: orb330138

Description

Rabbit polyclonal antibody to PCBP1

Research Area

Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PCBP1
TargetPCBP1
Protein SequenceSynthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
Molecular Weight39kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HNRPX antibody, anti HNRPE1 antibody, anti hnRNP-X antibody, anti hnRNP-E1 antibody

Similar Products

  • PCBP1 Rabbit Polyclonal Antibody [orb330139]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PCBP1 Rabbit Polyclonal Antibody [orb692204]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PCBP1 rabbit pAb Antibody [orb771939]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • PCBP1 Rabbit Polyclonal Antibody (PE) [orb489818]

    ICC,  IF

    Bovine, Equine, Human, Mouse, Porcine

    Rabbit

    Polyclonal

    PE

    100 μl
  • PCBP1 Rabbit Polyclonal Antibody [orb395147]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PCBP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody Dilution: 1 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/mL, Peptide Concentration: 2.0 ug/mL, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2.

PCBP1 Rabbit Polyclonal Antibody

WB Suggested Anti-PCBP1 Antibody Titration: 1.25 ug/mL, Positive Control: HepG2 cell lysate, PCBP1 is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006187

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PCBP1 Rabbit Polyclonal Antibody (orb330138)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 6,890.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry