Cart summary

You have no items in your shopping cart.

PCBP1 Rabbit Polyclonal Antibody

SKU: orb330139

Description

Rabbit polyclonal antibody to PCBP1

Research Area

Cell Biology, Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of Human PCBP1
TargetPCBP1
Protein SequenceSynthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
Molecular Weight37 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti HNRPE1 antibody, anti HNRPX antibody, anti hnRNP-E1 antibody, anti hnRNP-X antibody

Similar Products

  • PCBP1 Rabbit Polyclonal Antibody [orb692204]

    ELISA,  FC,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PCBP1 Rabbit Polyclonal Antibody [orb330138]

    WB

    Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
  • PCBP1 rabbit pAb Antibody [orb771939]

    ELISA,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • PCBP1 Rabbit Polyclonal Antibody (PE) [orb489818]

    ICC,  IF

    Bovine, Equine, Human, Mouse, Porcine

    Rabbit

    Polyclonal

    PE

    100 μl
  • PCBP1 Rabbit Polyclonal Antibody [orb395147]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PCBP1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. A second isoform of 33 kDa also contains the peptide, and the protein is phosphorylated.

PCBP1 Rabbit Polyclonal Antibody

Anti-PCBP1 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody Dilution: 1 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Tissue: Human HCT116, Antibody Dilution: 1.0 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 1 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Sample Type: MCF7 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL, PCBP1 is supported by BioGPS gene expression data to be expressed in MCF7.

PCBP1 Rabbit Polyclonal Antibody

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

PCBP1 Rabbit Polyclonal Antibody

Rabbit Anti-PCBP1 Antibody, Paraffin Embedded Tissue: Human Breast, Antibody Concentration: 5 ug/mL.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006187

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PCBP1 Rabbit Polyclonal Antibody (orb330139)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
¥ 7,800.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry