Recombinant Human ErbB3 Fragment (rHu ErbB3-f)

SKU: orb1494978

Description

ErbB3, also called Her3 (human epidermal growth factor receptor 3), is a type I membrane glycoprotein that is a member of the ErbB family of tyrosine kinase receptors. ErbB family members serve as receptors for the epidermal growth factor (EGF) family of growth factors. Among ErbB family members, ErbB3 is unique in that it contains a defective kinase domain. ErbB3 is expressed in keratinocytes, melanocytes, skeletal muscle cells, embryonic myoblasts and Schwann cells. Monomeric ErbB3 serves as a low affinity receptor for the heregulins (HRG). rhErbB3-f is a recombinant genetic engineering product which expressed in E. Coli. RhErbB3-f can induce specific antibody production in vivo, hence to inhibit tumor cell growth. The product can be used to treat early, medium and advanced or post-operative breast cancer patients with over-expression of ErbB2. According to its mechanism of action, rhErbB3-f is classified into therapeutic cancer vaccine.

Images & Validation

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20°C. Further dilutions should be made in appropriate buffered solutions. Read more...

Key Properties

−

Source	Escherichia coli.
Biological Activity	Fully biologically active. Measured by its ability to postpone tumor emerge time of spontaneous breast cancer in FVB/N transgenic mice and inhibit the development of tumor, effectively inhibit the growth of in situ transplanted breast cancer in FVB/N transgenic mice.
Molecular Weight	Approximately 34 kDa, a single non-glycosylated fusion polypeptide chain, containing 171 amino acids (Ser20- Cys190) with N-terminus Thioredoxin Tag and His tag.
Protein Sequence	MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHP DLGTDDDDKAMADIGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYN TNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVC
Purification	>95% by SDS-PAGE and HPLC analyses.
Purity	>95% by SDS-PAGE and HPLC analyses.
Endotoxins	Less than 1EU/μg of rHuErbB3-f as determined by LAL method.

Storage & Handling

−

Storage	This liquid suspension is stable for several months at 0-4°C, but should be kept at -20°C for long term storage. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Form/Appearance	A white, semitransparent suspension, the normal content of each vial is 1 mg of rhErbB3-f, 1mg aluminum hydroxide and small amount of arginine, sodium chloride, sodium phosphate, and potassium phosphate.
Buffer/Preservatives	A white, semitransparent suspension, the normal content of each vial is 1 mg of rhErbB3-f, 1mg aluminum hydroxide and small amount of arginine, sodium chloride, sodium phosphate, and potassium phosphate.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Find More Protocols